Hurry! This free trial offer expires in ...

Warning! Could not display error message!

Turn on renewal

To provide you with additional information about how we collect and use your personal data, we’ve recently updated our Privacy Policy and Terms of Service. Please review these pages now, as they apply to your continued use of our website.

Photos
Vectors
Clipart
Videos

Photos Vectors Illustrations Videos

Royalty Free Editorial

Portrait Square Landscape Panorama

Only with people Safe Search

Color Monochrome

188

Microsoft Stock Video Footage

Get access to thousands of high quality Microsoft Video Footage from Megapixl. Download now and enhance your project with stunning visuals.

refine

Related Searches:

microsoft logomicrosoft antitrustmicrosoft incmicrosoft metaversemicrosoft phonesharepointactivision blizzardvirtual landsalesforceminecraftmalwareivankagetin noble bankbusinessblockchainbill gates

Microsoft corporate building

Exterior of a Microsoft store

Microsoft corporate building

Exterior of a Microsoft store

Motion of Microsoft corporate building against blue sky

People playing new computer at Microsoft store

People playing new computer at Microsoft store

People playing new computer at Microsoft store

People playing new computer at Microsoft store

Motion of people browsing at Microsoft store inside Burnaby shopping mall

Empty conference hall in Microsoft store on 5th avenue in Manhattan

Surface Go tablet ps in Microsoft store

Microsoft windows Start key and selecting Update and Shut down computer

Installation process of Microsoft Windows 10 NEC Spectraview display

Motion of people playing new computer and tapping on screen

Microsoft office Vancouver

Videoconference apps Google Hangout Microsoft Teams Houseparty Whatsapp Google Duo Skype Business Zoom Meeting Cisco

Microsoft Windows 10

Microsoft Windows Phone - accepting terms of use

December 9, 2021 - Kehl, Germany: Two joysticks in black and white on the table in front of the game console White

December 9, 2021 - Kehl, Germany: Two joysticks in black and white on the table in front of the game console White

Exterior of a apple store

Business man try vr glasses hololens in the dark room. Portrait of young asian boy experience ar communication. Future

Business woman try vr glasses hololens in the dark room | Portrait of young asian girl experience ar communication | Future

Business woman try vr glasses hololens in the dark room | Portrait of young asian girl experience ar communication | Future

Business woman try vr glasses hololens in the dark room | Portrait of young asian girl experience ar communication | Future

Youtube Flag Waving in Wind Continuous Seamless Loop Background.

Accepting software license terms

Man unboxing new gamer Razer Blade Stealth laptop sent by Amazon

Man unboxing new gamer Razer Blade Stealth laptop sent by Amazon windows 10 installations

Man unboxing new gamer Razer Blade Stealth laptop sent by Amazon windows 10 installations

tilt aerial footage of the Wells Fargo buildings, the Microsoft buildings, skyscrapers and cars driving on the street

orbit aerial footage of the Wells Fargo buildings, the Microsoft buildings, skyscrapers and cars driving on the freeway

aerial footage of the rooftop lounge on top of the Microsoft building with skyscrapers and office buildings

tilt aerial footage of the Wells Fargo buildings, the Microsoft buildings, skyscrapers and cars driving on the freeway on a cloudy

tilt shot of the a tall glass hotel with a LeBron James advertisement, the JW Marriott and the Microsoft Theater with skyscrapers

Microsoft. Typing in search box

NOVEMBER 4, 2023: Using New Bing Microsoft Chatbot on an iPhone

Microsoft company headquarters glass building concept loopable

Microsoft office in Paris - CITY OF PARIS, FRANCE - SEPTEMBER 05, 2023

2022: Microsoft Headlines Fast Sequence

2022: Microsoft Headlines Fast Sequence

2022: Microsoft Headlines Fast Sequence

Best Buy retail store technology 2023 Microsoft Surface Pro 9 display

Microsoft company in Paris France - CITY OF PARIS, FRANCE - SEPTEMBER 04, 2023

Microsoft company headquarters glass building concept

Microsoft company headquarters glass building concept

Microsoft company headquarters glass building concept

Downloading and installing Microsoft Word from the App Store on your MacBook.

MARCH 28, 2024: Analyzing Microsoft Corporation Common Stock, 2019-2024: Animated Graph Insights

Cologne, Germany, September 20 2023: The main office of Microsoft in Germany in the center of Cologne. Tall glass

Microsoft company in Paris France - CITY OF PARIS, FRANCE - SEPTEMBER 04, 2023

FEBRUARY 28, 2023: Bing, Microsoft AI Chat, iPhone Screen Close-up of an Example of Chat a Person Can Have with It

Cologne, Germany, September 20 2023: The main office of Microsoft in Germany in the center of Cologne. Tall glass

Barcelona , Spain - February 27 2023: Mobile world congress 2023 in Barcelona. Booth or stand of Microsoft

Paris, France, August 02 2022: The main office of Microsoft in France in the center of Paris. Tall glass skyscrapers

2th of December, 2023, Middenmeer, The Netherlands, Construction of a new Microsoft datacenter, the AMS13 14 located at

Paris, France, September 20 2022: The main office of Microsoft in France in the center of Paris. Tall glass skyscrapers

Paris, France, September 20 2022: The main office of Microsoft in France in the center of Paris. Tall glass skyscrapers

Facade of the MICROSOFT Rome office in the EUR district. IT company based in Redmond

Facade of the MICROSOFT Rome office in the EUR district. IT company based in Redmond

FEBRUARY 27, 2023: Bing, Microsoft AI Chat, Macbook Screen Close-up of an Example of Chat a Person Can Have with It

FaÃ§ade of the Microsoft Rome office in the EUR district. IT company based in Redmond

Middenmeer, 8th of December 2023, The Netherlands. Microsoft Agriport cloud datacenter in Hollands Kroon. Aerial drone

Paris, France, August 02 2022: The main office of Microsoft in France in the center of Paris. Tall glass skyscrapers

Paris, France, 31 July 2022: Boy near Microsoft sign at the entrance of the headquarters building in Issy les Moulineaux

Paris, France, 31 July 2022: Microsoft sign at the entrance of the headquarters building in France

Paris, France, 31 July 2022: Microsoft sign at the entrance of the headquarters building in France

Paris, France, 31 July 2022: Microsoft sign at the entrance of the headquarters building in France

Middenmeer , 29th of August 2022, The Netherlands. Microsoft AMS06 datacenter computing center in Hollands Kroon. Data

Middenmeer , 29th of August 2022, The Netherlands. Microsoft AMS06 datacenter computing center in Hollands Kroon. Data

Middenmeer , 29th of August 2022, The Netherlands. Microsoft AMS06 datacenter computing center in Hollands Kroon. Data

FEBRUARY 27, 2023: Bing, Microsoft AI Chat, iPhone Screen Close-up of an Example of Chat a Person Can Have with It

FEBRUARY 27, 2023: Bing, Microsoft AI Chat, iPhone Screen Close-up of an Example of Chat a Person Can Have with It

Paris, France, 31 July 2022: Microsoft sign at the entrance of the headquarters building in Issy les Moulineaux

Paris, France, 31 July 2022: Microsoft sign at the entrance of the headquarters building in Issy les Moulineaux

Paris, France, 31 July 2022: Microsoft sign at the entrance of the headquarters building in Issy les Moulineaux

Middenmeer , 29th of August 2022, The Netherlands. Microsoft AMS06 datacenter computing center in Hollands Kroon. Data

Middenmeer , 29th of August 2022, The Netherlands. Microsoft AMS06 datacenter computing center in Hollands Kroon. Data

Middenmeer , 29th of August 2022, The Netherlands. Microsoft AMS06 datacenter computing center in Hollands Kroon. Data

Middenmeer , 29th of August 2022, The Netherlands. Microsoft AMS06 datacenter computing center in Hollands Kroon. Data

Microsoft - businessman working with virtual reality at office.

Aerial view of the Keilaniemi neighborhood of Espoo, Finland

Paris, France, 18 May 2023: The main office of Microsoft in France in the center of Paris. Tall glass skyscrapers

Paris, France, 18 May 2023: The main office of Microsoft in France in the center of Paris. Tall glass skyscrapers

A variety of cell phones from various brands and models displayed together in one photograph, Microscopic view of bacteria in a

Computer data moving fast on the screen - close up

Computer data moving fast on the screen - close up

2024: Generative AI, Headlines Collage Pop-up

A video of a cellphone screen display analyzing data

Software office buildings

Software office buildings

Software office buildings

5g network signal covers all things, Internet technology holographic City

1990s Technology relics in cave

person typing on keyboard on numeric pad

Cloud computing data center background

male hands typing on computer keyboard and mouse

finger presses the windows button on the laptop keyboard

Smart city cloud service network coverage and data transmission

NEXT PAGE

Next
of 2 pages

Photos
Abstract
Animals
Business
Editorial

Technology
Nature
People
Travel

Vectors
Banners
Buttons
Icons
Backgrounds

Clipart
Hand Drawn & Artistic
3D & Computer Generated

Videos
Abstract
Business
People
Editorial

Editorial
2D & 3D Animation
Video Production Elements
Technology
Travel

Technology
Travel

© 2024 Megapixl, all rights reserved

Stock Photography
Stock Illustrations & Clipart
Stock Vectors
Stock Video
Terms & Conditions

Free Stock Images
Facebook Timeline Images
Dreamstime Stock Photos
About Us
Privacy Policy
FAQ
Contact Us

About Us
Privacy Policy
Terms & Conditions
FAQ
Contact Us

Keep in touch with us

Hi there!

Glad you decided to join.

Your Email

Password

or log in

By clicking "Create account" you agree to the terms and conditions.

Sign up with Google Sign up with Twitter

Welcome back!

Your Email

Password

or create an account

Forgot password?

Login with Google Login with Twitter

Confirm action

Special Dreamstime offer

1 week free trial. Any size, for free

Renews at $25/month, cancel or upgrade at any time

Click here for your free trial!

240,570,031 images | 1,213,881 contributors | 53,281,022 total users